PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G011000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 479aa    MW: 52743.1 Da    PI: 8.7254
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G011000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.92.6e-42183260178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +CqvegC+ dls+ak+yhr+h+vCe hskap+v+v+gle+rfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk+q+
  Manes.13G011000.1.p 183 RCQVEGCNLDLSSAKDYHRKHRVCESHSKAPKVIVAGLERRFCQQCSRFHGLSEFDEKKRSCRRRLSDHNARRRKPQP 260
                          6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-35176245IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.411181258IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.05E-40182263IPR004333Transcription factor, SBP-box
PfamPF031102.1E-32184257IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MSSLSLMELN TKTPIQWDWE NLIMFNTTEH PKKLRWTEWE IDGDRGIDSG SLYSSGSGSG  60
CGGSGSDLGL ASLSKSSKSA SINSSSVGEV KTSKFTLEVS EAIPEDSNNK KALTKAKPTG  120
TFTLEASVGS GELLGLKLGK RTYFEDVCAG NNAKTSASSV IPGSSLSPAK RSKSNGQASP  180
APRCQVEGCN LDLSSAKDYH RKHRVCESHS KAPKVIVAGL ERRFCQQCSR FHGLSEFDEK  240
KRSCRRRLSD HNARRRKPQP EPIQLNPARL SPSLYDERQQ MSFVWNSVPL VHSRPNANLT  300
WEGTSSSKFT ITKEYVMKPP KVGCIDRQLH LPGNKLTSSI PMHSHDSKCL LPSRSKVTTA  360
EVISQGLEES IISPNVDATQ DLHRALSLLS TNSWGSCEQK SVSHEQPAHA SHTGMPQFMP  420
HVMPQGMPLA SSDYWRTEQT TDSRVHNLAT NNDNSSYFQE FQMLRAPYDS EFYSSQLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281842571184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1239256KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012085695.10.0PREDICTED: squamosa promoter-binding-like protein 2
TrEMBLA0A067JVJ10.0A0A067JVJ1_JATCU; Uncharacterized protein
STRINGPOPTR_0003s17120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-71squamosa promoter binding protein-like 2